FBXW9 Antibody - Azide and BSA Free

Western Blot: FBXW9 Antibody [H00084261-B01P] - Analysis of FBXW9 expression in transfected 293T cell line by FBXW9 polyclonal antibody. Lane 1: FBXW9 transfected lysate(14.85 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FBXW9 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse FBXW9 Antibody - Azide and BSA Free (H00084261-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: FBXW9 (ENSP00000254324, 1 a.a. - 135 a.a.) full-length human protein. MTGTSSQAARTTPWWWWTAEPTASCSVCSWTPTCSACPTRNPSSGLVTTRACCTSSPTATAASSLSGPLMWATAFPSLGSSTPWEPCTPHPLTRPSGCTCPQTHQGPFAPEGMTMGSIGSVLRATWWWPALETCR
• Specificity: FBXW9 - F-box and WD repeat domain containing 9,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: FBXW9
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FBXW9 Antibody - Azide and BSA Free

• F-box and WD repeat domain containing 9
• F-box and WD-40 domain protein 9
• F-box and WD-40 domain-containing protein 9
• F-box and WD-40 repeat containing protein 9
• specificity factor for SCF ubiquitin ligase

Background

Members of the F-box protein family, such as FBXW9, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603034), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FBXW9
• Entrez:
  • 84261(Human)
• Uniprot:
  • ENSP00000254324(Human)