FAM76A Antibody


Western Blot: FAM76A Antibody [NBP3-09312] - Western blot analysis using NBP3-09312 on Human MCF-7 as a positive control. Antibody Titration: 0.2-1 ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

FAM76A Antibody Summary

The immunogen is a synthetic peptide directed towards the N terminal region of human FAM76A (NP_689873). Peptide sequence MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESK
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS buffer, 2% sucrose.
0.09% Sodium Azide
Affinity purified

Alternate Names for FAM76A Antibody

  • family with sequence similarity 76, member A
  • FLJ41946
  • hypothetical protein LOC199870
  • MGC34648


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM76A Antibody (NBP3-09312) (0)

There are no publications for FAM76A Antibody (NBP3-09312).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM76A Antibody (NBP3-09312) (0)

There are no reviews for FAM76A Antibody (NBP3-09312). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM76A Antibody (NBP3-09312) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FAM76A Products

Bioinformatics Tool for FAM76A Antibody (NBP3-09312)

Discover related pathways, diseases and genes to FAM76A Antibody (NBP3-09312). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM76A

There are no specific blogs for FAM76A, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM76A Antibody and receive a gift card or discount.


Gene Symbol FAM76A