![Western Blot: FAM26E Antibody [NBP2-84917] - Host: Rabbit. Target Name: FAM26E. Sample Type: Fetal Lung lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize2/FAM26E-Antibody-Western-Blot-NBP2-84917-img0001.jpg "Western Blot: FAM26E Antibody [NBP2-84917] - Host: Rabbit. Target Name: FAM26E. Sample Type: Fetal Lung lysates. Antibody Dilution: 1.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human FAM26E. Peptide sequence: ELICKGKPKECWEELHKVSCGKTSMLPTVNEELKLSLQAQSQILGWCLIC The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FAM26E |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IHC-P | Mouse | 08/14/2020 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FAM26E |
