FAM26E Antibody

Images

 
Western Blot: FAM26E Antibody [NBP2-84917] - Host: Rabbit. Target Name: FAM26E. Sample Type: Fetal Lung lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM26E Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human FAM26E. Peptide sequence: ELICKGKPKECWEELHKVSCGKTSMLPTVNEELKLSLQAQSQILGWCLIC The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Equine (100%), Rabbit (92%), Guinea Pig (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
FAM26E
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Reviewed Applications
Read 1 Review rated 3
using
NBP2-84917 in the following application:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM26E Antibody

  • dJ493F7.3
  • family with sequence similarity 26, member E

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM26E Antibody (NBP2-84917) (0)

There are no publications for FAM26E Antibody (NBP2-84917).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for FAM26E Antibody (NBP2-84917) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP2-84917:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin FAM26E NBP2-84917
Enlarge
3
reviewed by:
Mario Grossi
IHC-P Mouse 08/14/2020
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedAdult heart
SpeciesMouse
LotQC40803-41304

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM26E Antibody (NBP2-84917) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM26E Products

Bioinformatics Tool for FAM26E Antibody (NBP2-84917)

Discover related pathways, diseases and genes to FAM26E Antibody (NBP2-84917). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM26E

There are no specific blogs for FAM26E, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Mario Grossi
08/14/2020
Application: IHC-P
Species: Mouse

Bioinformatics

Gene Symbol FAM26E