FAM13C1 Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

FAM13C1 Recombinant Protein Summary

Description
FAM13C1 (Human) GST-Tagged Recombinant Protein (P01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MFSCFCFSLQDNSFSSTTVTECDEDPVSLHEDQTDCSSLRDENNKENYPDAGALVEEHAPPSWEPQQQNVEATVLVDSVLRHSMGNFKSRKPKSIFKAESGRSHGESQETEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKDAFETRQDLNEEEAAQVHGVKDPAPASTQSVLADGTDSADPSPVHKDGQNEADSAPEDLHSVGTSRLLYHITDGDNPLLSPRCSIFSQSQRFNLDPESAPSPPSTQQFMMPRSSSRCSCGDGKEPQTITQLTKHIQSLKRKIRKFEEKFEQEKKYRPSHGDKTSNPEVLKWMNDLAKGRKQLKELKLKLSEEQGSAPKGPPRNLLCEQPTVPRENGKPEAAGPEPSSSGEETPDAALTCLKERREQLPPQEDSKVTKQDKNLIKPLYDRYRIIKQILSTPSLIPTIQEEEDSDEDRPQGSQQPSLADPASHLPVGDHLTYSNETEPVRALLPDEKKEVKPPALSMSNLHEATMPVLLDHLRETRADKKRLRKALREFEEQFFKQTGRSPQKEDRIPMADEYYEYKHIKAKLRLLEVLISKQDVAKTI
Preparation
Method
in vitro wheat germ expression system
Gene
FAM13C

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Western blot, ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FAM13C1 Recombinant Protein

  • FAM13C1
  • family with sequence similarity 13, member C
  • hypothetical protein LOC220965
  • member C1
  • MGC33233

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90810
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88825
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FAM13C1 Recombinant Protein (H00220965-P01) (0)

There are no publications for FAM13C1 Recombinant Protein (H00220965-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM13C1 Recombinant Protein (H00220965-P01) (0)

There are no reviews for FAM13C1 Recombinant Protein (H00220965-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM13C1 Recombinant Protein (H00220965-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FAM13C1 Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for FAM13C1 Recombinant Protein (H00220965-P01)

Discover related pathways, diseases and genes to FAM13C1 Recombinant Protein (H00220965-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM13C1

There are no specific blogs for FAM13C1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol FAM13C

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00220965-P01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

FAM13A Antibody
NBP1-88825
FAM13A Antibody
NBP1-88825
FAM13A Antibody
NBP1-88825
FAM13C1 Antibody
NBP1-91884
FAM13C1 Antibody
NBP1-91884
FAM13C1 Antibody
NBP1-91884
FAM13B1 Antibody
NBP1-90810
FAM13B1 Antibody
NBP1-90810