ELOB/ELOC/VHL Complex Antibody

Images

 
Western Blot: ELOB/ELOC/VHL Complex Antibody [NBP2-82356] - WB Suggested Anti-TCEB2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: HepG2 cell lysate
Immunohistochemistry: ELOB/ELOC/VHL Complex Antibody [NBP2-82356] - Human kidney

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Gt, Gp, Rb, ZeSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ELOB/ELOC/VHL Complex Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ELOB/ELOC/VHL Complex. Peptide sequence: TARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQ The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (100%), Porcine (100%), Bovine (100%), Guinea Pig (93%), Rabbit (100%), Zebrafish (93%), Canine (100%), Goat (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Theoretical MW
13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ELOB/ELOC/VHL Complex Antibody

  • ELOB/ELOC/VHL Complex
  • Elongin B/Elongin C/VHL Complex

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ELOB/ELOC/VHL Complex Antibody (NBP2-82356) (0)

There are no publications for ELOB/ELOC/VHL Complex Antibody (NBP2-82356).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELOB/ELOC/VHL Complex Antibody (NBP2-82356) (0)

There are no reviews for ELOB/ELOC/VHL Complex Antibody (NBP2-82356). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELOB/ELOC/VHL Complex Antibody (NBP2-82356) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ELOB/ELOC/VHL Complex Antibody and receive a gift card or discount.