DNAJC5G Antibody

Images

 
Western Blot: DNAJC5G Antibody [H00285126-B01P] - Analysis of DNAJC5G expression in transfected 293T cell line by DNAJC5G polyclonal antibody. Lane 1: DNAJC5G transfected lysate(20.79 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DNAJC5G Antibody Summary

Immunogen
DNAJC5G (NP_775921, 1 a.a. - 189 a.a.) full-length human protein. MSTVKEAAHRLSKSEMSLYAVLDLKKGASPEDFKKSYSHSALLPHPPFEYHLGRKLALRYHPDKNPGNAQAAEIFKEINAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRYYFILNSCWFKTLVILCTLLTCCCFCCCCCFCCGALKPPPEQDSGRKYQQNVQSQPPRSGAKCDFRSEENSEDDF
Specificity
DNAJC5G - DnaJ (Hsp40) homolog, subfamily C, member 5 gamma,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
DNAJC5G
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DNAJC5G Antibody

  • CSP-gamma
  • DnaJ (Hsp40) homolog, subfamily C, member 5 gamma
  • dnaJ homolog subfamily C member 5G
  • FLJ40417
  • gamma cysteine string protein
  • gamma-CSP
  • Gamma-cysteine string protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2584
Species: Mu
Applications: Simple Western, WB
NBP2-46354
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, WB
MAB5695
Species: Hu, Mu
Applications: WB
NBP2-80457
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for DNAJC5G Antibody (H00285126-B01P) (0)

There are no publications for DNAJC5G Antibody (H00285126-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJC5G Antibody (H00285126-B01P) (0)

There are no reviews for DNAJC5G Antibody (H00285126-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNAJC5G Antibody (H00285126-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAJC5G Products

Bioinformatics Tool for DNAJC5G Antibody (H00285126-B01P)

Discover related pathways, diseases and genes to DNAJC5G Antibody (H00285126-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJC5G Antibody (H00285126-B01P)

Discover more about diseases related to DNAJC5G Antibody (H00285126-B01P).

Blogs on DNAJC5G

There are no specific blogs for DNAJC5G, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAJC5G Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC5G
Entrez
Uniprot