![Western Blot: DENND5B Antibody [NBP2-82837] - Host: Rabbit. Target Name: DENND5B. Sample Type: Lung Tumor lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/DENND5B-Antibody-Western-Blot-NBP2-82837-img0001.jpg "Western Blot: DENND5B Antibody [NBP2-82837] - Host: Rabbit. Target Name: DENND5B. Sample Type: Lung Tumor lysates. Antibody Dilution: 1.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Knockout (KO) Validated Rabbit DENND5B Antibody - BSA Free (NBP2-82837) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human DENND5B. Peptide sequence: ILPASLLHFLDAPVPYLMGLQSKEGTDRSKLELPQEANLCFVDIDNHFIE The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DENND5B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DENND5B |
![Western Blot: Rabbit Polyclonal DENND5B Antibody [NBP2-82837] - DENND5B Antibody incubation for WT, Control KO and DENND5B KO cells beta actin as a loading control. Human cell lines, 1:1000 dilution of antibody. Knock out cells did not show the band. Image from a verified customer review.](http://images.novusbio.com/fullsize/nbp2-82837_rabbit-polyclonal-dennd5b-antibody-western-blot-19122024122014..png "Western Blot: Rabbit Polyclonal DENND5B Antibody [NBP2-82837] - DENND5B Antibody incubation for WT, Control KO and DENND5B KO cells beta actin as a loading control. Human cell lines, 1:1000 dilution of antibody. Knock out cells did not show the band. Image from a verified customer review.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")