CSN7b Antibody - BSA Free

Images

 
Western Blot: CSN7b Antibody [NBP3-10829] - Western blot analysis of CSN7b in Human Jurkat Whole Cell lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Product Discontinued
View other related CSN7b Primary Antibodies

Order Details


    • Catalog Number
      NBP3-10829
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CSN7b Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit CSN7b Antibody - BSA Free (NBP3-10829) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CSN7b (NP_001269879.1). Peptide sequence GIEQQVLRANQYKENHNRTQQQVEAEVTNIKKTLKATASSSAQEMEQQLA
Clonality
Polyclonal
Host
Rabbit
Gene
COPS7B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for CSN7b Antibody - BSA Free

  • Arabidopsis, homolog) subunit 7B
  • COP9 constitutive photomorphogenic homolog subunit 7B (Arabidopsis)
  • COP9 signalosome complex subunit 7b
  • CSN7BMGC111077
  • FLJ12612
  • Signalosome subunit 7b

Background

Component of the COP9 signalosome complex (CSN), is a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CSN7b Antibody (NBP3-10829) (0)

There are no publications for CSN7b Antibody (NBP3-10829).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSN7b Antibody (NBP3-10829) (0)

There are no reviews for CSN7b Antibody (NBP3-10829). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CSN7b Antibody (NBP3-10829) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CSN7b Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol COPS7B