![Western Blot: C8orf33 Antibody [H00065265-B01P] - Analysis of C8orf33 expression in transfected 293T cell line by C8orf33 polyclonal antibody. Lane 1: C8orf33 transfected lysate(25.3 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/C8orf33-Antibody-Western-Blot-H00065265-B01P-img0004.jpg "Western Blot: C8orf33 Antibody [H00065265-B01P] - Analysis of C8orf33 expression in transfected 293T cell line by C8orf33 polyclonal antibody. Lane 1: C8orf33 transfected lysate(25.3 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | C8orf33 (AAH10001, 1 a.a. - 229 a.a.) full-length human protein. MAALGHLAGEAAAAPGPGTPCASRGARLPGPVSSARNPSTVCLCPEQPTCSNADSRAHPLGDEGGTASKKQKNKKKTRNRASVANGGEKASEKLAPEEVPLSAEAQAQQLAQELAWCVEQLELGLKRQKPTPKQKEQAIGAIRTLRSKRTPLPRKRQLMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLDMPDEEFRFNFF |
| Specificity | C8orf33 - chromosome 8 open reading frame 33, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | C8ORF33 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for C8orf33 Antibody (H00065265-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: C8orf33 Antibody [H00065265-B01P] - Analysis of purified antibody to C8orf33 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/C8orf33-Antibody-Immunocytochemistry-Immunofluorescence-H00065265-B01P-img0003.jpg "Immunocytochemistry/Immunofluorescence: C8orf33 Antibody [H00065265-B01P] - Analysis of purified antibody to C8orf33 on HeLa cell. (antibody concentration 10 ug/ml)")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")