Recombinant Human C5orf4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human C5orf4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-191 of Human C5orf4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFWQAQWERLLTTFEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKNEPVDPVKLRQSIRTVLFNQCMISFPMVVFLYPFLKWWRDPCRRELPTFHWFLLELAIFTLIEEVLFYYSHR

Protein/Peptide Type
Recombinant Protein
Gene
C5ORF4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human C5orf4 Protein

  • chromosome 5 open reading frame 4
  • FLJ13758
  • hypothetical protein LOC10826

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89407
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010826-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for C5orf4 Recombinant Protein (H00010826-P01) (0)

There are no publications for C5orf4 Recombinant Protein (H00010826-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C5orf4 Recombinant Protein (H00010826-P01) (0)

There are no reviews for C5orf4 Recombinant Protein (H00010826-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C5orf4 Recombinant Protein (H00010826-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional C5orf4 Products

C5orf4 H00010826-P01

Bioinformatics Tool for C5orf4 Recombinant Protein (H00010826-P01)

Discover related pathways, diseases and genes to C5orf4 Recombinant Protein (H00010826-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C5orf4 Recombinant Protein (H00010826-P01)

Discover more about diseases related to C5orf4 Recombinant Protein (H00010826-P01).
 

Pathways for C5orf4 Recombinant Protein (H00010826-P01)

View related products by pathway.

Research Areas for C5orf4 Recombinant Protein (H00010826-P01)

Find related products by research area.

Blogs on C5orf4

There are no specific blogs for C5orf4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

C5orf4 Antibody
NBP1-60125

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human C5orf4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol C5ORF4