![Western Blot: C21orf59 Antibody [H00056683-B01P] - Analysis of C21orf59 expression in K-562.](http://images.novusbio.com/fullsize/C21orf59-Antibody-Western-Blot-H00056683-B01P-img0005.jpg "Western Blot: C21orf59 Antibody [H00056683-B01P] - Analysis of C21orf59 expression in K-562.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse C21orf59 Antibody - Azide and BSA Free (H00056683-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | C21orf59 (NP_067077.1, 1 a.a. - 290 a.a.) full-length human protein. MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQIEELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKRHFHGVKDIKWRPR |
| Specificity | C21orf59 - chromosome 21 open reading frame 59, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | CFAP298 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for C21orf59 Antibody (H00056683-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CFAP298 |
| Entrez |
|
| Uniprot |
|
![Western Blot: C21orf59 Antibody [H00056683-B01P] - Analysis of C21orf59 expression in MCF-7.](http://images.novusbio.com/fullsize/C21orf59-Antibody-Western-Blot-H00056683-B01P-img0004.jpg "Western Blot: C21orf59 Antibody [H00056683-B01P] - Analysis of C21orf59 expression in MCF-7.")
![Western Blot: C21orf59 Antibody [H00056683-B01P] - Analysis of C21orf59 expression in transfected 293T cell line by C21orf59 polyclonal antibody. Lane 1: C21orf59 transfected lysate(31.9 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/C21orf59-Antibody-Western-Blot-H00056683-B01P-img0006.jpg "Western Blot: C21orf59 Antibody [H00056683-B01P] - Analysis of C21orf59 expression in transfected 293T cell line by C21orf59 polyclonal antibody. Lane 1: C21orf59 transfected lysate(31.9 KDa). Lane 2: Non-transfected lysate.")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")