C11orf53 Antibody

Immunohistochemistry-Paraffin: C11orf53 Antibody [NBP2-37953] - Staining of human colon shows moderate nuclear positivity in glandular cells.

Product Discontinued

C11orf53 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: STSCLSQLESGSIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSNDLPPKV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C11ORF53
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for C11orf53 Antibody

• chromosome 11 open reading frame 53
• hypothetical protein LOC341032
• MGC50104

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C11ORF53
• Uniprot:
  • Q8IXP5(Human)