bcl10-interacting CARD protein Recombinant Protein Antigen

Images

 
There are currently no images for bcl10-interacting CARD protein Protein (NBP2-38125PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

bcl10-interacting CARD protein Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C9ORF89.

Source: E. coli

Amino Acid Sequence: MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALQNSDCTELDSGSQSGELSNR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CARD19
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38125.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for bcl10-interacting CARD protein Recombinant Protein Antigen

  • bA370F5.1
  • bcl10-interacting CARD protein
  • Bcl10-interacting protein with CARD
  • BinCARD
  • chromosome 9 open reading frame 89
  • MGC110898
  • MGC11115

Background

C9orf89 plays a role in inhibiting the effects of BCL10-induced activation of NF-kappa-B. May inhibit thephosphorylation of BCL10 in a CARD-dependent manner

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02597
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-38125PEP
Species: Hu
Applications: AC

Publications for bcl10-interacting CARD protein Protein (NBP2-38125PEP) (0)

There are no publications for bcl10-interacting CARD protein Protein (NBP2-38125PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for bcl10-interacting CARD protein Protein (NBP2-38125PEP) (0)

There are no reviews for bcl10-interacting CARD protein Protein (NBP2-38125PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for bcl10-interacting CARD protein Protein (NBP2-38125PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional bcl10-interacting CARD protein Products

Research Areas for bcl10-interacting CARD protein Protein (NBP2-38125PEP)

Find related products by research area.

Blogs on bcl10-interacting CARD protein

There are no specific blogs for bcl10-interacting CARD protein, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our bcl10-interacting CARD protein Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CARD19