ATP6V0E2 Antibody

Western Blot: ATP6V0E2 Antibody [NBP1-55100] - Titration: 0.2-1 ug/ml, Positive Control: COLO205 cell lysate.

Product Discontinued

ATP6V0E2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to ATP6V0E2(ATPase, H+ transporting V0 subunit e2) The peptide sequence was selected from the middle region of ATP6V0E2. Peptide sequence TVAPLSLTTPSSGPSPTQLCLVTSSLLLAPRDPDPQGLPGSWKSSQSSQP. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to isoforms 2 and 3 of ATP6V0E2 (Uniprot: Q8NHE4-2, Q8NHE4-3).
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP6V0E2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against ATP6V0E2 and was validated on Western blot.
• Theoretical MW: 17-19 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ATP6V0E2 Antibody

• ATP6V0
• ATPase, H+ transporting V0 subunit e2
• chromosome 7 open reading frame 32
• H+ transporting V0 subunit E isoform 2-like (rat)
• Lysosomal 9 kDa H(+)-transporting ATPase V0 subunit e2

Background

Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.Multisubunit vacuolar-type proton pumps, or H(+)-ATPases, acidify various intracellular compartments, such as vacuoles, clathrin-coated and synaptic vesicles, endosomes, lysosomes, and chromaffin granules. H(+)-ATPases are also found in plasma membranes of specialized cells, where they play roles in urinary acidification, bone resorption, and sperm maturation. Multiple subunits form H(+)-ATPases, with proteins of the V1 class hydrolyzing ATP for energy to transport H+, and proteins of the V0 class forming an integral membrane domain through which H+ is transported. ATP6V0E2 encodes an isoform of the H(+)-ATPase V0 e subunit, an essential proton pump component (Blake-Palmer et al., 2007 [PubMed 17350184]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP6V0E2