ATP5SL Antibody

Images

 
Western Blot: ATP5SL Antibody [NBP2-82704] - Host: Rabbit. Target Name: ATP5SL. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/mlATP5SL is supported by BioGPS gene expression data to be expressed in ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP5SL Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ATP5SL. Peptide sequence: KRTILQFLTNYFYDVEALRDYLLQREMYKVHEKNRSYTWLEKQHGPYGAG The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ATP5SL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP5SL Antibody

  • ATP5SL ATP5S-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP5SL Antibody (NBP2-82704) (0)

There are no publications for ATP5SL Antibody (NBP2-82704).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP5SL Antibody (NBP2-82704) (0)

There are no reviews for ATP5SL Antibody (NBP2-82704). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP5SL Antibody (NBP2-82704) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ATP5SL Products

Bioinformatics Tool for ATP5SL Antibody (NBP2-82704)

Discover related pathways, diseases and genes to ATP5SL Antibody (NBP2-82704). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ATP5SL

There are no specific blogs for ATP5SL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP5SL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP5SL