ZNF70 Antibody (1E3.)

Images

 
Western Blot: ZNF70 Antibody (1E3) [H00007621-M06] - Analysis of ZNF70 expression in transfected 293T cell line by ZNF70 monoclonal antibody (M06), clone 1E3. Lane 1: ZNF70 transfected lysate (Predicted MW: 50.8 KDa). ...read more
Sandwich ELISA: ZNF70 Antibody (1E3) [H00007621-M06] - Detection limit for recombinant GST tagged ZNF70 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E3.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF70 Antibody (1E3.) Summary

Immunogen
ZNF70 (AAH40161, 1 a.a. - 446 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKEIPLGEQDEENDDYEGNFSLCSSPVQHQSIPPGTRPQDDELFGQTFLQKSDLSMCQIIHSEEPSPCDCAETDRGDSGPNAPHRTPQPAKPYACRECGKAFSQSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQIIHTGEKPYECRECGKAFRQSSALTQHQKIHTGKRPYECRECGKDFSRSSSLRKHERIHTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQRIHTGKKPYKCDECGKAFSQSSNLIEHRKTHTGEKPYKCQKCGKAFSQSSSLIEHQRIHTGEKPYECCQCGKAFCHSSALIQHQRIHTGKKPYTCECGKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL
Specificity
ZNF70 - zinc finger protein 70 (Cos17) (1E3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF70
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF70 Antibody (1E3.)

  • Cos17
  • MGC48959
  • zinc finger protein 70 (Cos17)
  • zinc finger protein 70
  • Zinc finger protein N27C7-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF70 Antibody (H00007621-M06) (0)

There are no publications for ZNF70 Antibody (H00007621-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF70 Antibody (H00007621-M06) (0)

There are no reviews for ZNF70 Antibody (H00007621-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF70 Antibody (H00007621-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF70 Products

Bioinformatics Tool for ZNF70 Antibody (H00007621-M06)

Discover related pathways, diseases and genes to ZNF70 Antibody (H00007621-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF70

There are no specific blogs for ZNF70, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF70 Antibody (1E3.) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF70
Entrez
Uniprot