Recombinant Human Zinc finger protein 180 Protein

Images

 
There are currently no images for Zinc finger protein 180 Recombinant Protein (H00007733-P01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Zinc finger protein 180 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-691 of Human ZNF180 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRRVYAGSWKRCAAQDLSTLLCLEESMEEQDEKPPEPPKACAQDSFLPQEIIIKVEGEDTGSLTIPSQEGVNFKIVTVDFTREEQGTWNPAQRTLDRDVILENHRDLVSWDLATAVGKKDSTSKQRIFDEEPANGVKIERFTRDDPWLSSCEEVDDCKDQLEKQQEKQEILLQEVAFTQRKAVIHERVCKSDETGEKSGLNSSLFSSPVIPIRNHFHKHVSHAKKWHLNAAVNSHQKINENETLYENNECGKPPQSIHLIQFTRTQTKDKCYGFSDRIQSFCHGTPLHIHEKIHGGGKTFDFKECGQVLNPKISHNEQQRIPFEESQYKCSETSHSSSLTQNMRNNSEEKPFECNQCGKSFSWSSHLVAHQRTHTGEKPYECSECGKSFSRSSHLVSHQRTHTGEKPYRCNQCGKSFSQSYVLVVHQRTHTGEKPYECNQCGKSFRQSYKLIAHQRTHTGEKPYECNQCGKSFIQSYKLIAHQRIHTGEKPYECNQCGKSFSQSYKLVAHQRTHTGEKPFECNQCGKSFSWSSQLVAHQRTHTGEKPYECSECGKSFNRSSHLVMHQRIHTGEKPYECNQCGKSFSQSYVLVVHQRTHTGEKPYECSQCGKSFRQSSCLTQHQRTHTGEKPFECNQCGKTFSLSARLIVHQRTHTGEKPFTCIQCGKAFINSYKLIRHQATHTEEKLYECN

Protein/Peptide Type
Recombinant Protein
Gene
ZNF180

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Zinc finger protein 180 Protein

  • HHZ168zinc finger protein 180 (HHZ168)
  • zinc finger protein 180

Background

Zinc finger proteins have been shown to interact with nucleic acids and to have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form 1 family of zinc finger proteins. See MIM 604749 for additional information on zinc finger proteins.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92618
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007733-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Zinc finger protein 180 Recombinant Protein (H00007733-P01) (0)

There are no publications for Zinc finger protein 180 Recombinant Protein (H00007733-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Zinc finger protein 180 Recombinant Protein (H00007733-P01) (0)

There are no reviews for Zinc finger protein 180 Recombinant Protein (H00007733-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Zinc finger protein 180 Recombinant Protein (H00007733-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Zinc finger protein 180 Products

Bioinformatics Tool for Zinc finger protein 180 Recombinant Protein (H00007733-P01)

Discover related pathways, diseases and genes to Zinc finger protein 180 Recombinant Protein (H00007733-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Zinc finger protein 180 Recombinant Protein (H00007733-P01)

Discover more about diseases related to Zinc finger protein 180 Recombinant Protein (H00007733-P01).
 

Pathways for Zinc finger protein 180 Recombinant Protein (H00007733-P01)

View related products by pathway.

Blogs on Zinc finger protein 180

There are no specific blogs for Zinc finger protein 180, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZNF181 Antibody
NBP1-92618

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Zinc finger protein 180 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF180