VSTM2L Antibody (3B9)

Images

 
Western Blot: VSTM2L Antibody (3B9) [H00128434-M01] - C20orf102 monoclonal antibody (M01), clone 3B9 Analysis of C20orf102 expression in IMR-32.
Western Blot: VSTM2L Antibody (3B9) [H00128434-M01] - Analysis of C20orf102 expression in transfected 293T cell line by C20orf102 monoclonal antibody (M01), clone 3B9.Lane 1: C20orf102 transfected lysate(22 KDa).Lane 2: ...read more
Sandwich ELISA: VSTM2L Antibody (3B9) [H00128434-M01] - Detection limit for recombinant GST tagged VSTM2L is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3B9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

VSTM2L Antibody (3B9) Summary

Immunogen
C20orf102 (AAH33818.1, 25 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGSYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL
Specificity
C20orf102 - chromosome 20 open reading frame 102
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
VSTM2L
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate, transfected lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publication using
H00128434-M01 in the following applications:

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VSTM2L Antibody (3B9)

  • C20orf102
  • chromosome 20 open reading frame 102
  • dJ1118M15.2
  • Gm691
  • V-set and transmembrane domain containing 2 like
  • V-set and transmembrane domain-containing protein 2-like protein
  • VSTM2L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for VSTM2L Antibody (H00128434-M01)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ELISA.


Filter By Application
ELISA
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using H00128434-M01 Applications Species
Klee, George G, Vasmatzis, George, Kosari et al. EXTRACELLULAR AND MEMBRANE-ASSOCIATED PROSTATE CANCER MARKERS FreshPatents 2010 Feb 04 (ELISA, Human) ELISA Human

Reviews for VSTM2L Antibody (H00128434-M01) (0)

There are no reviews for VSTM2L Antibody (H00128434-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VSTM2L Antibody (H00128434-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional VSTM2L Products

Bioinformatics Tool for VSTM2L Antibody (H00128434-M01)

Discover related pathways, diseases and genes to VSTM2L Antibody (H00128434-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VSTM2L Antibody (H00128434-M01)

Discover more about diseases related to VSTM2L Antibody (H00128434-M01).
 

Pathways for VSTM2L Antibody (H00128434-M01)

View related products by pathway.

Blogs on VSTM2L

There are no specific blogs for VSTM2L, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VSTM2L Antibody (3B9) and receive a gift card or discount.

Bioinformatics

Gene Symbol VSTM2L
Entrez
Uniprot