UBTD2 Antibody (1B8-1B1)

Images

 
Western Blot: UBTD2 Antibody (1B8-1B1) [H00092181-M01] - DC-UbP monoclonal antibody (M01), clone 1B8-1B1 Analysis of DC-UbP expression in A-431.
Western Blot: UBTD2 Antibody (1B8-1B1) [H00092181-M01] - DC-UbP monoclonal antibody (M01), clone 1B8-1B1 Western Blot analysis of DC-UbP expression in A-431 ( Cat # L015V1 ).
Western Blot: UBTD2 Antibody (1B8-1B1) [H00092181-M01] - Analysis of DC-UbP expression in transfected 293T cell line by DC-UbP monoclonal antibody (M01), clone 1B8-1B1.Lane 1: DC-UbP transfected lysate(21.5 KDa).Lane 2: ...read more
Sandwich ELISA: UBTD2 Antibody (1B8-1B1) [H00092181-M01] - Detection limit for recombinant GST tagged DC-UbP is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1B8-1B1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UBTD2 Antibody (1B8-1B1) Summary

Immunogen
DC-UbP (AAH19910, 1 a.a. ~ 191 a.a) full length recombinant protein with GST tag.MTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDH ELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPIN MIEEKSDIETLDIPEPPPNSGYECQLRLRLSTGKDLKLVVRS TDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKI PKDYVVQVIVSQPVQNPTPVEN
Localization
Cytoplasmic
Specificity
DC-UbP - dendritic cell-derived ubiquitin-like protein
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UBTD2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UBTD2 Antibody (1B8-1B1)

  • DC-UbP
  • DCUBPDendritic cell-derived ubiquitin-like protein
  • MGC30022ubiquitin domain-containing protein 2
  • ubiquitin domain containing 2
  • Ubiquitin-like protein SB72

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for UBTD2 Antibody (H00092181-M01) (0)

There are no publications for UBTD2 Antibody (H00092181-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBTD2 Antibody (H00092181-M01) (0)

There are no reviews for UBTD2 Antibody (H00092181-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBTD2 Antibody (H00092181-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBTD2 Products

Bioinformatics Tool for UBTD2 Antibody (H00092181-M01)

Discover related pathways, diseases and genes to UBTD2 Antibody (H00092181-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for UBTD2 Antibody (H00092181-M01)

View related products by pathway.

PTMs for UBTD2 Antibody (H00092181-M01)

Learn more about PTMs related to UBTD2 Antibody (H00092181-M01).

Blogs on UBTD2

There are no specific blogs for UBTD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBTD2 Antibody (1B8-1B1) and receive a gift card or discount.

Bioinformatics

Gene Symbol UBTD2
Entrez
Uniprot