UBE2U Antibody (3D4) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: UBE2U Antibody (3D4) [H00148581-M07] - Analysis of monoclonal antibody to UBE2U on HeLa cell. Antibody concentration 10 ug/ml

Sandwich ELISA: UBE2U Antibody (3D4) [H00148581-M07] - Detection limit for recombinant GST tagged UBE2U is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA, ICC/IF
• Clone: 3D4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

UBE2U Antibody (3D4) - Azide and BSA Free Summary

• Immunogen: UBE2U (NP_689702.1, 9 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LHRDFCDLKENNYKGITAKPVSEDMMEWEVEIEGLQNSVWQGLVFQLTIHFTSEYNYAPPVVKFITIPFHPNVDPHTGQPCIDFLDNPEKWNTN
• Specificity: ubiquitin-conjugating enzyme E2U (putative)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: UBE2U
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
• Application Notes: Antibody reactive against recombinant protein on ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UBE2U Antibody (3D4) - Azide and BSA Free

• EC 6.3.2.19
• MGC35130
• RP4-636O23.1
• Ubiquitin carrier protein U
• ubiquitin-conjugating enzyme E2 U
• ubiquitin-conjugating enzyme E2U (putative)
• Ubiquitin-protein ligase U

Background

UBE2U - ubiquitin-conjugating enzyme E2U (putative)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UBE2U
• Entrez:
  • 148581(Human)
• Uniprot:
  • NP_689702.1(Human)