![Western Blot: UBE2DNL Antibody (2F7) [H00340561-M01] - MGC42638 monoclonal antibody (M01), clone 2F7. Analysis of MGC42638 expression in IMR-32.](http://images.novusbio.com/fullsize/UBE2DNL-Antibody-2F7-Western-Blot-H00340561-M01-img0003.jpg "Western Blot: UBE2DNL Antibody (2F7) [H00340561-M01] - MGC42638 monoclonal antibody (M01), clone 2F7. Analysis of MGC42638 expression in IMR-32.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 2F7 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse UBE2DNL Antibody (2F7) - Azide and BSA Free (H00340561-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | MGC42638 (AAH40290, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MALKLIHKEFLELARDPQPHCSAGPVWDDMLHWQATITRPNDSSYLGGVFFLKFPSDYLFKPPKIKFTNGIYHQR |
| Specificity | MGC42638 - hypothetical protein MGC42638 (2F7) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | UBE2DNL |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Sandwich ELISA: UBE2DNL Antibody (2F7) [H00340561-M01] - Detection limit for recombinant GST tagged UBE2DNL is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/UBE2DNL-Antibody-2F7-Sandwich-ELISA-H00340561-M01-img0002.jpg "Sandwich ELISA: UBE2DNL Antibody (2F7) [H00340561-M01] - Detection limit for recombinant GST tagged UBE2DNL is 0.3 ng/ml as a capture antibody.")
