TWISTNB Recombinant Protein Antigen

Images

 
There are currently no images for TWISTNB Protein (NBP1-89449PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TWISTNB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TWISTNB.

Source: E. coli

Amino Acid Sequence: QTMEINMGDELEFEVFRLDSDAAGVFCIRGKLNITSLQFKRSEVSEEVTENGTEEAAKKPKKKKKKKDPETYEVDSGTTKLAD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TWISTNB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89449.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TWISTNB Recombinant Protein Antigen

  • DNA-directed RNA polymerase I subunit RPA43
  • Twist neighbor protein
  • TWIST neighbor

Background

RPA43 is a component of the RNA polymerase I complex which synthesizes ribosomal RNA precursors. RPA43 is also known as TWISTNB (twist neighbor protein), a gene identified within a genomic region (7p21) that is deleted in patients with Saethre-Chotzen syndrome and specific learning disabilities.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NBP2-93194
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
NBP2-24716
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-91897
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for TWISTNB Protein (NBP1-89449PEP) (0)

There are no publications for TWISTNB Protein (NBP1-89449PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TWISTNB Protein (NBP1-89449PEP) (0)

There are no reviews for TWISTNB Protein (NBP1-89449PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TWISTNB Protein (NBP1-89449PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TWISTNB Products

Blogs on TWISTNB

There are no specific blogs for TWISTNB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TWISTNB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TWISTNB