Testis serine protease 5 Antibody - BSA Free

Immunohistochemistry: Testis serine protease 5 Antibody [NBP2-31815] - Staining of gallbladder.

Immunohistochemistry: Testis serine protease 5 Antibody [NBP2-31815] - Staining of breast cancer.

Immunohistochemistry: Testis serine protease 5 Antibody [NBP2-31815] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.

Product Discontinued

Testis serine protease 5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AHCIQGTKEYSVVLGTSKLQPMNFSRALWVPVRDIIMHPKYWGRAFIMGDVALVHLQTP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRSS45
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Testis serine protease 5 Antibody - BSA Free

• EC 3.4.21.-
• protease, serine, 45
• putative testis serine protease 5
• serine protease 45
• TESSP5Testis serine protease 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRSS45
• Uniprot:
  • Q7RTY3(Human)