Testis serine protease 5 Antibody


Immunohistochemistry: Testis serine protease 5 Antibody [NBP2-31815] - Staining of gallbladder.
Immunohistochemistry: Testis serine protease 5 Antibody [NBP2-31815] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry: Testis serine protease 5 Antibody [NBP2-31815] - Staining of gallbladder.
Immunohistochemistry: Testis serine protease 5 Antibody [NBP2-31815] - Staining of breast cancer.
Immunohistochemistry: Testis serine protease 5 Antibody [NBP2-31815] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry: Testis serine protease 5 Antibody [NBP2-31815] - Staining of breast cancer.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Testis serine protease 5 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: AHCIQGTKEYSVVLGTSKLQPMNFSRALWVPVRDIIMHPKYWGRAFIMGDVALVHLQTP
Specificity of human Testis serine protease 5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Testis serine protease 5 Protein (NBP2-31815PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Testis serine protease 5 Antibody

  • EC 3.4.21.-
  • protease, serine, 45
  • putative testis serine protease 5
  • serine protease 45
  • TESSP5Testis serine protease 5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, ELISA, IHC-P, IP

Publications for Testis serine protease 5 Antibody (NBP2-31815) (0)

There are no publications for Testis serine protease 5 Antibody (NBP2-31815).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Testis serine protease 5 Antibody (NBP2-31815) (0)

There are no reviews for Testis serine protease 5 Antibody (NBP2-31815). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Testis serine protease 5 Antibody (NBP2-31815) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Testis serine protease 5 Products

Bioinformatics Tool for Testis serine protease 5 Antibody (NBP2-31815)

Discover related pathways, diseases and genes to Testis serine protease 5 Antibody (NBP2-31815). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Testis serine protease 5

There are no specific blogs for Testis serine protease 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Testis serine protease 5 Antibody and receive a gift card or discount.


Gene Symbol PRSS45