![Immunohistochemistry-Paraffin: SZT2 Antibody [NBP1-89886] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SZT2-Antibody-Immunohistochemistry-Paraffin-NBP1-89886-img0004.jpg "Immunohistochemistry-Paraffin: SZT2 Antibody [NBP1-89886] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.")
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FTSLSVGLPETLKPLISAQPPQWRCYARLVNPQHVFLTFLPATFSDVQRLAACGLEGPPQEETKPKFGDWSG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SZT2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-89886 | Applications | Species |
|---|---|---|
| Cattelani C, Lesiak D, Liebscher G Et al. The SZT2 Interactome Unravels New Functions of the KICSTOR Complex Cells 2021-10-09 [PMID: 34685691] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SZT2 |
