SgK071 Antibody (2B5) - Azide and BSA Free

Western Blot: SgK071 Antibody (2B5) [H00169436-M03] - Analysis of C9orf96 expression in transfected 293T cell line by C9orf96 monoclonal antibody (M03), clone 2B5. Lane 1: C9orf96 transfected lysatE (75.5 KDa). Lane 2: Non-transfected lysate.

Western Blot: SgK071 Antibody (2B5) [H00169436-M03] - Western blot analysis of C9orf96 over-expressed 293 cell line. Lane 2 cotransfected with C9orf96 Validated Chimera RNAi Lane 1 non-transfected control. Blot probed with H00169436-M03. GAPDH(36.1 kDa) used as loading control.

ELISA: SgK071 Antibody (2B5) [H00169436-M03] - Detection limit for recombinant GST tagged C9orf96 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, KD
• Clone: 2B5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SgK071 Antibody (2B5) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SgK071 Antibody (2B5) - Azide and BSA Free (H00169436-M03) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: C9orf96 (NP_714921, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLGPGSNRRRPTQGERGPGSPGEPMEKYQVLYQLNPGALGVNLVVEEMETKVKHVIKQVECMDDHYASQALEELMPLLKLRHAHISVYQELFITWNGEI
• Specificity: C9orf96 - chromosome 9 open reading frame 96
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: C9ORF96
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Knockdown Validated
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein for western blot. It has also been used for RNAi validation and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SgK071 Antibody (2B5) - Azide and BSA Free

• chromosome 9 open reading frame 96
• MGC43306
• protein kinase-like protein SgK071
• RP11-244N20.8
• SgK071
• Sk521
• Sugen kinase 071

Background

C9orf96 belongs to the serine/threonine protein kinase family. However, the protein kinase domain is predicted to be catalytically inactive. The specific function of this protein is unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C9ORF96
• Entrez:
  • 169436(Human)
• Uniprot:
  • NP_714921(Human)