![Western Blot: PTD016 Antibody (4H7) [H00051136-M01] - Analysis of LOC51136 expression in transfected 293T cell line by LOC51136 monoclonal antibody (M01), clone 4H7.Lane 1: LOC51136 transfected lysate(23.2 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/PTD016-Antibody-4H7-Western-Blot-H00051136-M01-img0002.jpg "Western Blot: PTD016 Antibody (4H7) [H00051136-M01] - Analysis of LOC51136 expression in transfected 293T cell line by LOC51136 monoclonal antibody (M01), clone 4H7.Lane 1: LOC51136 transfected lysate(23.2 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 4H7 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse PTD016 Antibody (4H7) - Azide and BSA Free (H00051136-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | LOC51136 (NP_057209, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQANRSQLHSPPGTGSSEDASTPQCVHTRLTGEGSCPHSGDVHIQINSIPKECAENASSRNIRSGVHSCAHGCVHSRLRGHSHSEARLTDDTAAESGDHG |
| Specificity | LOC51136 - PTD016 protein |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | RNFT1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
