Protocadherin gamma A8 Antibody (1C11) - Azide and BSA Free

Western Blot: Protocadherin gamma A8 Antibody (1C11) [H00009708-M01] - Analysis of PCDHGA8 expression in transfected 293T cell line by PCDHGA8 monoclonal antibody (M01), clone 1C11.Lane 1: PCDHGA8 transfected lysate(101.48 KDa).Lane 2: Non-transfected lysate.

Western Blot: Protocadherin gamma A8 Antibody (1C11) [H00009708-M01] - Analysis of PCDHGA8 over-expressed 293 cell line, cotransfected with PCDHGA8 Validated Chimera RNAi ( Cat # H00009708-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PCDHGA8 monoclonal antibody (M01), clone 1C11 (Cat # H00009708-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Sandwich ELISA: Protocadherin gamma A8 Antibody (1C11) [H00009708-M01] - Detection limit for recombinant GST tagged PCDHGA8 is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, KD
• Clone: 1C11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Protocadherin gamma A8 Antibody (1C11) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Protocadherin gamma A8 Antibody (1C11) - Azide and BSA Free (H00009708-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PCDHGA8 (NP_114477, 357 a.a. ~ 444 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LENSLPGTVIAFLSVHDQDSGKNGQVVCYTRDNLPFKLEKSIGNYYRLVTRKYLDRENVSIYNITVMASDLGTPPLSTETQIALHVAD
• Localization: Cell Membrane
• Specificity: PCDHGA8 - protocadherin gamma subfamily A, 8
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PCDHGA8
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against transfected lysate and recombinant protein for Western Blot. Has also been used for ELISA and RNAi Validation.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Protocadherin gamma A8 Antibody (1C11) - Azide and BSA Free

• KIAA0327PCDH-GAMMA-A8
• PCDH-gamma-A8
• protocadherin gamma subfamily A, 8
• protocadherin gamma-A8

Background

This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PCDHGA8
• Entrez:
  • 9708(Human)
• OMIM:
  • 606295(Human)
• Uniprot:
  • NP_114477(Human)