PLEKHH3 Antibody (4F8) - Azide and BSA Free

Western Blot: PLEKHH3 Antibody (4F8) [H00079990-M03] - Detection against Immunogen (35.2 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4F8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PLEKHH3 Antibody (4F8) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PLEKHH3 Antibody (4F8) - Azide and BSA Free (H00079990-M03) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PLEKHH3 (NP_079203, 665 a.a. ~ 750 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DVLELSTEPGRGAPQKLCLGLGAKAMSLSRPGETEPIHSVSYGHVAACQLMGPHTLALRVGESQLLLQSPQVEEIMQLVNAYLANP
• Specificity: PLEKHH3 - pleckstrin homology domain containing, family H (with MyTH4 domain) member 3 (4F8)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PLEKHH3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PLEKHH3 Antibody (4F8) - Azide and BSA Free

• FLJ21019
• PH domain-containing family H member 3
• pleckstrin homology domain containing, family H (with MyTH4 domain) member 3
• pleckstrin homology domain-containing family H member 3

Background

PLEKHH3, also referred to as Pleckstrin homology domain-containing family H member 3, is cleaved into multiple isoforms including the canonical sequence, which is 793 amino acids long and approximately 85kDa. Little research has been conducted on the function of PLEKHH3, however, bioinformatics show that it may be related to Ubiquitin C.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLEKHH3
• Entrez:
  • 79990(Human)
• Uniprot:
  • NP_079203(Human)