PIGS Antibody (3F3)

Images

 
Western Blot: PIGS Antibody (3F3) [H00094005-M02] - PIGS monoclonal antibody (M02), clone 3F3. Analysis of PIGS expression in NIH/3T3.
Sandwich ELISA: PIGS Antibody (3F3) [H00094005-M02] - Detection limit for recombinant GST tagged PIGS is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3F3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PIGS Antibody (3F3) Summary

Immunogen
PIGS (NP_149975.1, 450 a.a. ~ 518 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GKISNIVIKDDVASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQK
Specificity
PIGS - phosphatidylinositol glycan, class S (3F3)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PIGS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PIGS Antibody (3F3)

  • DKFZp686K20216
  • FLJ45226
  • GPI transamidase component PIG-S
  • GPI transamidase subunit
  • phosphatidylinositol glycan anchor biosynthesis, class S
  • phosphatidylinositol glycan, class S
  • Phosphatidylinositol-glycan biosynthesis class S protein

Background

This gene encodes a protein that is involved in GPI-anchor biosynthesis. The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PIGS Antibody (H00094005-M02) (0)

There are no publications for PIGS Antibody (H00094005-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGS Antibody (H00094005-M02) (0)

There are no reviews for PIGS Antibody (H00094005-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIGS Antibody (H00094005-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIGS Products

Array H00094005-M02

Bioinformatics Tool for PIGS Antibody (H00094005-M02)

Discover related pathways, diseases and genes to PIGS Antibody (H00094005-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for PIGS Antibody (H00094005-M02)

View related products by pathway.

Blogs on PIGS

There are no specific blogs for PIGS, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIGS Antibody (3F3) and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGS
Entrez
Uniprot