PCDHB15 Antibody (2E10)

Images

 
Western Blot: PCDHB15 Antibody (2E10) [H00056121-M02] - Detection against Immunogen (36.74 KDa) .

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2E10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PCDHB15 Antibody (2E10) Summary

Immunogen
PCDHB15 (NP_061758, 207 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ELRLTLTAVDGGSPPRSGTVQILILVLDANDNAPEFVQALYEVQVPENSPVGSLVVKVSARDLDTGTNGEISYSLYYSSQEIDKPFELSSLSGEIRLIKK
Specificity
PCDHB15 (2E10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PCDHB15
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PCDHB15 Antibody (2E10)

  • PCDH-BETA15
  • PCDH-beta-15
  • protocadherin beta 15
  • protocadherin beta-15

Background

This gene is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily. The extracellular domains interact in a homophilic manner to specify differential cell-cell connections. Unlike the alpha and gamma clusters, the transcripts from these genes are made up of only one large exon, not sharing common 3' exons as expected. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins. Their specific functions are unknown but they most likely play a critical role in the establishment and function of specific cell-cell neural connections.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PCDHB15 Antibody (H00056121-M02) (0)

There are no publications for PCDHB15 Antibody (H00056121-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCDHB15 Antibody (H00056121-M02) (0)

There are no reviews for PCDHB15 Antibody (H00056121-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCDHB15 Antibody (H00056121-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCDHB15 Products

Bioinformatics Tool for PCDHB15 Antibody (H00056121-M02)

Discover related pathways, diseases and genes to PCDHB15 Antibody (H00056121-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PCDHB15

There are no specific blogs for PCDHB15, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCDHB15 Antibody (2E10) and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDHB15
Entrez
OMIM
Uniprot