OR2A2 Antibody (4B10) - Azide and BSA Free

Sandwich ELISA: OR2A2 Antibody (4B10) [H00442361-M01] - Detection limit for recombinant GST tagged OR2A2 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 4B10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

OR2A2 Antibody (4B10) - Azide and BSA Free Summary

• Immunogen: OR2A2 (NP_001005480.1, 261 a.a. ~ 318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PDSNQREEQEKMLSLFHSVLNPMLNPLIYSLRNAQLKGALHRALQRKRSMRTVYGLCL
• Specificity: Reacts with olfactory receptor, family 2, subfamily A, member 2.
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: OR2A2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OR2A2 Antibody (4B10) - Azide and BSA Free

• Olfactory receptor 2A17
• olfactory receptor 2A2
• Olfactory receptor OR7-11
• olfactory receptor, family 2, subfamily A, member 17 pseudogene
• olfactory receptor, family 2, subfamily A, member 2 pseudogene
• olfactory receptor, family 2, subfamily A, member 2
• OR2A17P
• OR2A2P
• OR7-11
• OST008

Background

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OR2A2
• Entrez:
  • 442361(Human)
• Uniprot:
  • NP_001005480(Human)