OR1I1 Antibody (1G6) - Azide and BSA Free

Sandwich ELISA: OR1I1 Antibody (1G6) [H00126370-M04] - Detection limit for recombinant GST tagged OR1I1 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1G6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

OR1I1 Antibody (1G6) - Azide and BSA Free Summary

• Immunogen: OR1I1 (NP_001004713.1, 293 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RNKDMKAALGKLIGKVAVPCPRPEQLLDVYHVPGSLLAARDTEMHPIPYPGGVQSLAGNRDME
• Specificity: This product is specific for Human OR1I1 monoclonal antibody (M04), clone 1G6 [Gene ID: 126370].
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: OR1I1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Mouse monoclonal antibody raised against a partial recombinant OR1I1.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OR1I1 Antibody (1G6) - Azide and BSA Free

• Olfactory receptor 19-20
• olfactory receptor 1I1
• olfactory receptor, family 1, subfamily I, member 1
• OR19-20OR1I1P
• OR1I1Q

Background

OR1I1 is an olfactory receptor that interacts with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. Members of a large family of G protein coupled receptors 7 transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein mediated transduction of odorant signals.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OR1I1
• Uniprot:
  • NP_001004713.1(Human)