Recombinant Human NRSN2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NRSN2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-204 of Human NRSN2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MMPSCNRSCSCSRGPSVEDGKWYGVRSYLHLFYEDCAGTALSDDPEGPPVLCPRRPWPSLCWKISLSSGTLLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGTALCVAAGVLLAICLFWAMIGWLSQDTKAEPLDPEADSHVEVFGDEPEQQLSPIFRNASGQSWFSPPASPFGQSSVQTIQPKRDS

Protein/Peptide Type
Recombinant Protein
Gene
NRSN2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NRSN2 Protein

  • C20orf98
  • chromosome 20 open reading frame 98
  • dJ1103G7.6
  • FLJ23329
  • neurensin 2
  • neurensin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00080023-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for NRSN2 Recombinant Protein (H00080023-P01) (0)

There are no publications for NRSN2 Recombinant Protein (H00080023-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NRSN2 Recombinant Protein (H00080023-P01) (0)

There are no reviews for NRSN2 Recombinant Protein (H00080023-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NRSN2 Recombinant Protein (H00080023-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NRSN2 Products

Bioinformatics Tool for NRSN2 Recombinant Protein (H00080023-P01)

Discover related pathways, diseases and genes to NRSN2 Recombinant Protein (H00080023-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NRSN2 Recombinant Protein (H00080023-P01)

Discover more about diseases related to NRSN2 Recombinant Protein (H00080023-P01).

Blogs on NRSN2

There are no specific blogs for NRSN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NRSN1 Antibody
NBP2-31844
NRSN2 Antibody
NBP1-88290

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NRSN2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NRSN2