MS4A15 Antibody (1D4)

Images

 
Sandwich ELISA: MS4A15 Antibody (1D4) [H00219995-M03] - Detection limit for recombinant GST tagged MS4A15 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
1D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MS4A15 Antibody (1D4) Summary

Immunogen
MGC35295 (AAH31610.1, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVRRGHVGIFFIEGGVPFWGGACFIISGSLSVAAEKNHTSCLVRSSLGTNILSVMAAFAGTAILLMDFGVTNRDVDRGYLAVLTIFTVLEFFTAVIAMHFGCQAIHAQASAPVIFLPNAFSADFNIPSPAASAPPAYDNVAYAQGVV
Specificity
MGC35295 - hypothetical protein MGC35295 (1D4)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MS4A15
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
This product is useful for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MS4A15 Antibody (1D4)

  • FLJ34527
  • membrane-spanning 4-domains subfamily A member 15
  • membrane-spanning 4-domains, subfamily A, member 15
  • MGC35295

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MS4A15 Antibody (H00219995-M03) (0)

There are no publications for MS4A15 Antibody (H00219995-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MS4A15 Antibody (H00219995-M03) (0)

There are no reviews for MS4A15 Antibody (H00219995-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MS4A15 Antibody (H00219995-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MS4A15 Products

Bioinformatics Tool for MS4A15 Antibody (H00219995-M03)

Discover related pathways, diseases and genes to MS4A15 Antibody (H00219995-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MS4A15

There are no specific blogs for MS4A15, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MS4A15 Antibody (1D4) and receive a gift card or discount.

Bioinformatics

Gene Symbol MS4A15
Entrez
Uniprot