MRPS26 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MRPS26 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRPS26.
  
  

  Source: E. coli

  Amino Acid Sequence: EVLQLQEEVKNFITRENLEARVEAALDSRKNYNWAITREGLVVRPQRRDS

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MRPS26
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92141.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MRPS26 Recombinant Protein Antigen

• C20orf193
• dJ534B8.3
• GI008,28S ribosomal protein S13, mitochondrial
• mitochondrial ribosomal protein S26
• MRP-S13MRPS13
• MRP-S26chromosome 20 open reading frame 193
• NY-BR-87
• RPMS1328S ribosomal protein S26, mitochondrial
• S13mt
• S26mt
• serologically defined breast cancer antigen NY-BR-87

Background

MRPS26, also known as Mitochondrial Ribosomal Protein S26, consists of a 205 amino acid isoform that is 24 kDa, and is involved in protein synthesis, though its specific function within the process is unknown. Current research is currently being conducted on the between MRPS26 and a variety of diseases and disorders, including Dubin-Johnson syndrome, gout, and breast cancer. MRPS26 has been linked to the DNA damage response and the peptide biosynthetic process, through which it interacts with several proteins, such as ICT1, PPP2CA, USP42, LMNA, and KBTBD7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MRPS26