Recombinant Human Methyltransferase like 6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Methyltransferase like 6 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 255 of Human METTL6 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKVFQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVNKKEGL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
METTL6
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Methyltransferase like 6 Protein

  • EC 2.1.1
  • EC 2.1.1.-
  • EC 2.1.1.41
  • methyltransferase like 6
  • methyltransferase-like protein 6
  • MGC24132

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-76962
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC

Publications for Methyltransferase like 6 Recombinant Protein (H00131965-P01) (0)

There are no publications for Methyltransferase like 6 Recombinant Protein (H00131965-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Methyltransferase like 6 Recombinant Protein (H00131965-P01) (0)

There are no reviews for Methyltransferase like 6 Recombinant Protein (H00131965-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Methyltransferase like 6 Recombinant Protein (H00131965-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Methyltransferase like 6 Products

Bioinformatics Tool for Methyltransferase like 6 Recombinant Protein (H00131965-P01)

Discover related pathways, diseases and genes to Methyltransferase like 6 Recombinant Protein (H00131965-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Methyltransferase like 6 Recombinant Protein (H00131965-P01)

Discover more about diseases related to Methyltransferase like 6 Recombinant Protein (H00131965-P01).

Research Areas for Methyltransferase like 6 Recombinant Protein (H00131965-P01)

Find related products by research area.

Blogs on Methyltransferase like 6

There are no specific blogs for Methyltransferase like 6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MID1 Antibody
NBP1-26612

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Methyltransferase like 6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol METTL6