We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

LIN-13 Antibody

Images

 
Western Blot: LIN-13 Antibody [41910002] This image is specific to animal number SDQ2970 Dilution: 1:1000 Very weak. ON expo
Immunocytochemistry/ Immunofluorescence: LIN-13 Antibody [41910002] - This image is specific for animal number SDQ2944 Dilution: 1:3000
Western Blot: LIN-13 Antibody [41910002] - This image is specific for animal number SDQ2944 Dilution: 1:1000

Product Details

Summary
Product Discontinued
View other related LIN-13 Primary Antibodies

Order Details


    • Catalog Number
      41910002
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LIN-13 Antibody Summary

Immunogen
In vivo generated recombinant protein fragment
Epitope
PMPIRQQPQQIKPAYSLVRPDIIAPNELMRPYTLTPAIRPGQRIKPYKVPRTSRWYSCSWCDREYESLNQFVDHLTRFHTHPCPSCGKAFSSQNTRRTHV
Specificity
Caenorhabditis elegans LIN-13
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LIN13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:250-1:2000
  • Western Blot 1:2000-1:10000
Application Notes
This antibody works in ELISA, Immunohistochemistry, Immunofluorescence (animal number SDQ2944 only) and Western Blot.

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
Preservative
No Preservative
Concentration
1 mg/ml
Purity
Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Background

Lin-13 encodes a large (2248-residue) nuclear protein with multiple zinc fingers of the C2H2 class and a LXCXE retinoblastoma protein-binding motif, that is required for survival through larval development and for negative regulation of vulval fates during postembryonic development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Supplier Logo

Publications for LIN-13 Antibody (41910002) (0)

There are no publications for LIN-13 Antibody (41910002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIN-13 Antibody (41910002) (0)

There are no reviews for LIN-13 Antibody (41910002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LIN-13 Antibody (41910002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Research Areas for LIN-13 Antibody (41910002)

Find related products by research area.

Blogs on LIN-13

There are no specific blogs for LIN-13, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIN-13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LIN13