LIN-13 Antibody

Western Blot: LIN-13 Antibody [41910002] This image is specific to animal number SDQ2970 Dilution: 1:1000 Very weak. ON expo

Immunocytochemistry/Immunofluorescence: LIN-13 Antibody [41910002] - This image is specific for animal number SDQ2944 Dilution: 1:3000

Western Blot: LIN-13 Antibody [41910002] - This image is specific for animal number SDQ2944 Dilution: 1:1000

Product Discontinued

LIN-13 Antibody Summary

• Immunogen: In vivo generated recombinant protein fragment
• Epitope: PMPIRQQPQQIKPAYSLVRPDIIAPNELMRPYTLTPAIRPGQRIKPYKVPRTSRWYSCSWCDREYESLNQFVDHLTRFHTHPCPSCGKAFSSQNTRRTHV
• Specificity: Caenorhabditis elegans LIN-13
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LIN13
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:250-1:2000
  • Western Blot 1:2000-1:10000
• Application Notes: This antibody works in ELISA, Immunohistochemistry, Immunofluorescence (animal number SDQ2944 only) and Western Blot.

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
• Preservative: No Preservative
• Concentration: 1 mg/ml
• Purity: Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Background

Lin-13 encodes a large (2248-residue) nuclear protein with multiple zinc fingers of the C2H2 class and a LXCXE retinoblastoma protein-binding motif, that is required for survival through larval development and for negative regulation of vulval fates during postembryonic development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LIN13