| Immunogen | In vivo generated recombinant protein fragment |
| Epitope | PRRSVNYASIERGDEAQAQSLVTDFGSRGNRKKPKRTRDELDENYMEENEGNSGRKKKPNAKGASRQFQVPGLPTYASQYSRPPKQEDVFKTIVPLAEDA |
| Specificity | This antibody is specific to C. elegans LIN13 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LIN13 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody is useful in Chromatin Immunoprecipitation and Immunofluorescence. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl |
| Preservative | No Preservative |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for LIN-13 Antibody (29570002)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.