LET-418 Antibody

Western Blot: LET-418 Antibody [48960002] This image is specific to animal number SDQ3905 dilution 1:10000

Immunocytochemistry/Immunofluorescence: LET-418 Antibody [48960002] - This image is specific to animal number SDQ3905 MeOH fixation, dilution 1:25 000

Western Blot: LET-418 Antibody [48960002] This image is specific to animal number SDQ3861 dilution 1:10000

Immunocytochemistry/Immunofluorescence: LET-418 Antibody [48960002] - This image is specific to animal number SDQ 3861 MeOH fixation, dilution 1:10 000

Product Discontinued

LET-418 Antibody Summary

• Immunogen: In vivo generated recominant protein fragment
• Epitope: RAAEREEKKKGALEAARAAKKAKLEKGEEAENNDYCEECKQDGELLLCDTCPRAYHTVCIDENMEEPP EGDWSCAHCIEHGPEVVKEEPAKQNDEFCKIC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Western Blot 1:100-1:2000
• Application Notes: This product is useful for ELISA, Western Blot, and Immunofluorescence.

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
• Preservative: No Preservative
• Concentration: 1 mg/ml
• Purity: Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for LET-418 Antibody

• Protein LET-418

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LET-418 Antibody (48960002)(1)

Publication using 48960002

• Kim H, Ding Y, Lu S et al. PIE-1 promotes SUMOylation and activation of HDAC1 during the C. elegans oogenesis bioRxiv 2020-08-18 (WB, C. elegans)