KLHDC7B Antibody

Images

 
Immunohistochemistry-Paraffin: KLHDC7B Antibody [NBP1-81188] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells and neuropil.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLHDC7B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GLCTMHNYLFLAGGIRGSGAKAVCSNEVFCYNPLTNIWSQVRPMQQARAQLKLVALDGLLYAIGGECLYSMECYDPRTDAWTPRAPLPAGTFPVAHEAVACRGDIYVTGGHLFYRLLRYSPVKDAWDECPYSASHRRSSDIV
Specificity
Specificity of human KLHDC7B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLHDC7B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KLHDC7B Protein (NBP1-81188PEP)
Publications
Read Publication using
NBP1-81188 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KLHDC7B Antibody

  • kelch domain containing 7B
  • kelch domain-containing protein 7B
  • MGC16635

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81188
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for KLHDC7B Antibody (NBP1-81188)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for KLHDC7B Antibody (NBP1-81188) (0)

There are no reviews for KLHDC7B Antibody (NBP1-81188). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KLHDC7B Antibody (NBP1-81188) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KLHDC7B Products

Bioinformatics Tool for KLHDC7B Antibody (NBP1-81188)

Discover related pathways, diseases and genes to KLHDC7B Antibody (NBP1-81188). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLHDC7B Antibody (NBP1-81188)

Discover more about diseases related to KLHDC7B Antibody (NBP1-81188).

Blogs on KLHDC7B

There are no specific blogs for KLHDC7B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLHDC7B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLHDC7B
Entrez
Uniprot