HPL-2 Antibody

Images

 
Western Blot: HPL-2 Antibody [38630002] - WB analysis of HPL2 in C. elegans lysate. Image courtesy of anonymous customer product review.
Immunocytochemistry/ Immunofluorescence: HPL-2 Antibody [38630002] - This image is specific to animal number SDQ2340 MeOH/acetone fixation antibody dilution 1:4000
Immunocytochemistry/ Immunofluorescence: HPL-2 Antibody [38630002] - This image is specific to animal number SDQ2324 MeOH/acetone fixation antibody dilution 1:2000

Product Details

Summary
Reactivity CeSpecies Glossary
Applications WB, ChIP, ELISA, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HPL-2 Antibody Summary

Immunogen
In vivo generated recombinant protein fragment
Epitope
EDPKDNVFMVEKVLDKRTGKAGRDEFLIQWQGFPESDSSWEPRENLQCVEMLDEFEREFSKREKPIRKRHSQKPEPSEDQADPEEDKDEKKETNQNDKFS
Specificity
This antibody is specific to C. elegans HPL2.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HPL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Chromatin Immunoprecipitation 1:10-1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
Application Notes
This antibody is useful in Chromatin Immunoprecipitation, Western Blot, ELISA and Immunofluorescence.
Reviewed Applications
Read 1 Review rated 4
using
38630002 in the following applications:

Publications
Read Publications using 38630002.

Reactivity Notes

C. elegans

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for HPL-2 Antibody

  • HP1 Like (heterochromatin protein)
  • HPL-2

Background

hpl-2 encodes one of two C. elegans heterochromatin protein 1 (HP1) homologs; hpl-2 activity is required for silencing of transgenes in the germline, germline development, and vulval cell fate specification; in addition, hpl-2 negatively regulates RNA-mediated interference (RNAi); hpl-2 also functions redundantly with hpl-1 in larval, somatic gonad and germline development, and redundantly with hpl-1, lin-13, lin-15A, lin-9, and lin-35 in vulval development; HPL-2 reporter fusion proteins are expressed in nuclei throughout the life cycle with expression also seen in the germline and developing oocytes; in nuclei, HPL-2 fusion proteins are associated with condensed chromatin; HPL-2::RFP foci do not significantly overlap with those of HPL-1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Supplier Logo

Publications for HPL-2 Antibody (38630002)(2)

Review for HPL-2 Antibody (38630002) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Other.
We have 1 review tested in 1 application: WB.

Reviews using 38630002:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Other
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot HPL-2 38630002
Enlarge
reviewed by:
Yogesh Ostwal
WB Other 08/03/2012
View

Summary

ApplicationWestern Blot
Sample Testedworm lysate
SpeciesOther
LotG3048-040A02

Blocking

Blocking Details5 % milk solution

Primary Anitbody

Dilution Ratio1: 2000

Secondary Antibody

Secondary DescriptionSwine anti-rabbit IgG, HRP
Secondary Concentration1: 2000

Details

Detection NotesECL; 30 sec

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar
ICC/IF Video Protocol

FAQs for HPL-2 Antibody (38630002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HPL-2 Products

HPL-2 38630002

Bioinformatics Tool for HPL-2 Antibody (38630002)

Discover related pathways, diseases and genes to HPL-2 Antibody (38630002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for HPL-2 Antibody (38630002)

Find related products by research area.

Blogs on HPL-2

There are no specific blogs for HPL-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Yogesh Ostwal
08/03/2012
Application: WB
Species: Other

Bioinformatics

Gene Symbol HPL2
Entrez