hmg-3 Antibody

Immunocytochemistry/Immunofluorescence: hmg-3 Antibody [38690002] - This image is specific to animal number SDQ2362 Methanol fixation; 1 hr

Product Discontinued

hmg-3 Antibody Summary

• Immunogen: In vivo generated recombinant protein fragment
• Epitope: AKKAGAKWKSMSADDKKEWNDKAAQDKARYEAEMKEYKKNGGGVEKASGPSTKKSSDQSPGKQFKSKEHISDTDDSDDDEPLKAKKDESDAASESSGESD
• Specificity: Caenorhabditis elegans HMG-3
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
• Application Notes: This product is useful for ELISA and for Immunofluorescence.

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for hmg-3 Antibody

• Protein HMG-3

Background

Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II. Binds specifically to double-stranded DNA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Entrez:
  • 172250(C. elegans)
• Uniprot:
  • O01683(C. elegans)