hcp-3 Antibody

Immunocytochemistry/Immunofluorescence: hcp-3 Antibody [29540002] - CENP-AHCP-3 on first-generation ACs at different cell stages, and that have been propagated for generations & endogenous chromosomes in GFP:LacI-, GFP:LacI:HDA-1- & GFP:LacI:HDA-1(H145A)-tethering strains. Images containing ACs & endogenous chromosomes shown. Embryos stained w/ antibody against CENP-AHCP-3 (red), LacI (green) & DAPI (blue), shown separate & merged. Ex. of bipolar-oriented CENP-AHCP-3 highlighted in red boxes. Quant. of IF signals. CENP-AHCP-3 signals normalized with DAPI signals, & ave. normalized CENP-AHCP-3 signal intensity calculated. Black arcs show comparisons between GFP::LacI-, GFP::LacI::HDA-1- & GFP::LacI::HDA-1(H145A)-tethering strain at same cell stage. Blue arcs show comparisons between ACs at different stages in GFP::LacI-tethering strain. Image collected & cropped by CiteAb from (epigeneticsandchromatin.biomedcentral.com/articles/10.1186/s13072-018-0185-1), licensed under CC-BY license.

Immunocytochemistry/Immunofluorescence: hcp-3 Antibody [29540002] - This antibody is specific for animal number Q0804 Dilution 1:500

Immunocytochemistry/Immunofluorescence: hcp-3 Antibody [29540002] - This image is specific to animal number Q0806 Dilution 1:500

Immunocytochemistry/Immunofluorescence: hcp-3 Antibody [29540002] - IF of CENP-AHCP-3 on first-generation ACs at different cell stages, and ACs that have been propagated for generations in GFP::LacI-tethering strain without and with alpha-amanitin treatment. Embryos were stained with antibody against CENP-AHCP-3 (red), LacI (green) and DAPI (blue), separately and merged. Scale bar=1um. Quantification of IF signals. CENP-AHCP-3 signals were normalized with DAPI signals, and the average normalized CENP-AHCP-3 signal intensity was calculated. NS means not significant. Black arcs show comparisons between no treatment and alpha-amanitin treatment at the same cell stage. The data for GFP:LacI-tethering strain without alpha-amanitin treatment are the same as in Fig. 3a. Image collected and cropped by CiteAb from the following publication (epigeneticsandchromatin.biomedcentral.com/articles/10.1186/s13072-018-0185-1), licensed under a CC-BY license.

Product Discontinued

hcp-3 Antibody Summary

• Immunogen: In vivo generated recombinant protein fragment to hcp-3
• Epitope: TSAAGVNDLIDILNQYKKELEDDAANDYTEAHIHKIRLVTGKRNQYVLKLKQAEDEYHARKEQARRRASSMDFTVGRNS
• Specificity: This antibody is specific for C. Elegans HCP-3
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Immunohistochemistry
  • Immunoprecipitation
  • Western Blot 1:100-1:2000
• Application Notes: Use in Immunohistochemistry reported in scientific literature (PMID:33872374)

Reactivity Notes

C. Elegans. Animal Number Q0804

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
• Preservative: No Preservative
• Concentration: 1.0 mg/ml
• Purity: Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for hcp-3 Antibody

• hcp3

Background

Histone H3-like variant which exclusively replaces conventional H3 in the nucleosome core of centromeric chromatin at the inner plate of the kinetochore. Required for recruitment and assembly of kinetochore proteins, mitotic progression and chromosome segregation. May serve as an epigenetic mark that propagates centromere identity through replication and cell division. Not required for chromosome segregation during meiosis. Forms a nucleosome-like histone octamer containing two molecules each of H2A, H2B, hcp-3 and H4 assembled in one hcp-3-H4 heterotetramer and two H2A-H2B heterodimers. The hcp-3-H4 heterotetramer is more compact and structurally more rigid than corresponding H3-H4 heterotetramers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for hcp-3 Antibody (29540002)(6)

Publications using 29540002

• Lin Z, Yuen KWY RbAp46/48LIN-53 and HAT-1 are required for initial CENP-AHCP-3 deposition and de novo holocentromere formation on artificial chromosomes in Caenorhabditis elegans embryos Nucleic acids research 2021-04-19 [PMID: 33872374] (IF/IHC)
• Zhu J, Cheng KCL, Yuen KWY. Histone H3K9 and H4 Acetylations and Transcription Facilitate the Initial CENP-AHCP-3 Deposition and De Novo Centromere Establishment in Caenorhabditis elegans Artificial Chromosomes. Epigenetics Chromatin 2018-04-13 [PMID: 29653589] (ICC/IF, C. elegans)
• Garrison C, Lastwika K, Zhang Y et al. Proteomic Analysis, Immune Dysregulation, and Pathway Interconnections With Obesity J Proteome Res. 2017-01-06 [PMID: 27769113] (MiAr)
  
  Details:
  Analysis is performed on plasma proteomic data to identify how obesity can alter pathways and to highlight the risk factor for disease in subjects with a high body mass index.
• Lee BC, Lin Z, Yuen KW. RbAp46/48(LIN-53) Is Required for Holocentromere Assembly in Caenorhabditis elegans. Cell Rep. 2016-03-01 [PMID: 26904949] (IP, WB, IF, C. elegans)
• Tu S, Wu MZ, Wang J et al. Comparative functional characterization of the CSR-1 22G-RNA pathway in Caenorhabditis nematodes. Nucleic Acids Res. 2015-01-09 [PMID: 25510497] (ICC/IF)
  
  Details:
  hcp-3 antibody used for Immunofluorescence staining of C. briggsae embryo (Figure 3).
• Rho JH, Lampe PD. High-throughput screening for native autoantigen-autoantibody complexes using antibody microarrays J Proteome Res. 2013-05-03 [PMID: 23541305] (MiAr)
  
  Details:
  A novel method using antibody microarrays is used to detect autoantibody-antigen complexes that can potentially be useful for detection and characterization of diseases.

Review for hcp-3 Antibody (29540002) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Other.

reviewed by: William Lin WB Other 04/25/2015

Summary

• Application: Western Blot
• Sample Tested: Embryo
• Species: Other

Bioinformatics

• Entrez:
  • 176359(C. elegans)
• Uniprot:
  • P34470(C. elegans)