GTSF1L Antibody (5E7)

Images

 
Western Blot: GTSF1L Antibody (5E7) [H00149699-M03] - Analysis of GTSF1L expression in transfected 293T cell line by GTSF1L monoclonal antibody (M03), clone 5E7. Lane 1: GTSF1L transfected lysate (Predicted MW: 16.9 ...read more
Sandwich ELISA: GTSF1L Antibody (5E7) [H00149699-M03] - Detection limit for recombinant GST tagged GTSF1L is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
5E7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GTSF1L Antibody (5E7) Summary

Immunogen
GTSF1L (NP_789761.1, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEPEAFEICPYDPHHRIPLSRFQYHLASCRRKNPKKAKKMATCKYNACHVVPIKNLEEHEAVCVNRSAVEEEDTENPLKVSPPSSEQNDDTQQVSPCLPSPDIWNVDGANCQHVFVLKTFFPQKVVCENDTKESARETSPQKILRPGQ
Specificity
This product is specific for Human GTSF1L monoclonal antibody (M03), clone 5E7 [Gene ID: 149699].
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GTSF1L
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Sandwich ELISA
Application Notes
Mouse monoclonal antibody raised against a full-length recombinant GTSF1L.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GTSF1L Antibody (5E7)

  • C20orf65
  • chromosome 20 open reading frame 65
  • dJ1028D15.4
  • FAM112A
  • family with sequence similarity 112, member A
  • gametocyte specific factor 1-like
  • gametocyte-specific factor 1-like
  • MGC50820
  • Protein FAM112A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GTSF1L Antibody (H00149699-M03) (0)

There are no publications for GTSF1L Antibody (H00149699-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTSF1L Antibody (H00149699-M03) (0)

There are no reviews for GTSF1L Antibody (H00149699-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GTSF1L Antibody (H00149699-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GTSF1L Products

Bioinformatics Tool for GTSF1L Antibody (H00149699-M03)

Discover related pathways, diseases and genes to GTSF1L Antibody (H00149699-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GTSF1L

There are no specific blogs for GTSF1L, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTSF1L Antibody (5E7) and receive a gift card or discount.

Bioinformatics

Gene Symbol GTSF1L
Uniprot