We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GPR108 Recombinant Protein Antigen

Images

 
There are currently no images for GPR108 Protein (NBP1-82812PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GPR108 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPR108.

Source: E. coli

Amino Acid Sequence: VGFSLSRVRSGRVRSYSTRDFQDCPLQKNSSSFLVLFLINTKDLQVQVRKYGEQKTLFIFPGLLPEAPSKPGLPKPQATVPRKVDG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GPR108
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82812.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GPR108 Recombinant Protein Antigen

  • G protein-coupled receptor 108
  • GPR108
  • LUSTR2
  • LUSTR2Lung seven transmembrane receptor 2
  • MGC14393
  • protein GPR108

Background

LUSTR2 is an Orphan-U GPCR with an unknown ligand.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83629
Species: Hu
Applications: IHC,  IHC-P
NBP1-90095
Species: Hu
Applications:  IHC-P

Publications for GPR108 Protein (NBP1-82812PEP) (0)

There are no publications for GPR108 Protein (NBP1-82812PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR108 Protein (NBP1-82812PEP) (0)

There are no reviews for GPR108 Protein (NBP1-82812PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GPR108 Protein (NBP1-82812PEP). (Showing 1 - of FAQ).

    Additional GPR108 Products

    Array NBP1-82812PEP

    Blogs on GPR108

    There are no specific blogs for GPR108, but you can read our latest blog posts.

    Contact Information

    Product PDFs

    Calculators

    Concentration Calculator

    The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

    =
    ÷

    Molarity Calculator

    Calculate the mass, volume, or concentration required for a solution.

    The molarity calculator is based on the following equation:

    Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

    As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

    =
    x
    x
    g/mol

    Review this Product

    Be the first to review our GPR108 Recombinant Protein Antigen and receive a gift card or discount.

    Bioinformatics

    Gene Symbol GPR108