We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

FUT10 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: FUT10 Antibody [NBP2-31724] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemistry-Paraffin: FUT10 Antibody [NBP2-31724] - Staining of human cervix, uterine shows cytoplasmic and nuclear positivity in squamous epithelial cells.

Product Details

Summary
Product Discontinued
View other related FUT10 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-31724
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FUT10 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TALRERKWGVQDVNQDNYIDAFECMVCTKVWANIRLQEKGLPPKRWEAEDTHLSCPEPTVFAFSPLRTPP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FUT10
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FUT10 Antibody - BSA Free

  • alpha 1,3-fucosyl transferase
  • alpha-(1,3)-fucosyltransferase 10
  • EC 2.4.1
  • EC 2.4.1.-
  • fucosyltransferase 10 (alpha (1,3) fucosyltransferase)
  • Fucosyltransferase 10
  • Fucosyltransferase X
  • Fuc-TX
  • fucT-X
  • Galactoside 3-L-fucosyltransferase 10
  • MGC11141

Background

Plasmid: pCMV-FUT10 Full length

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5964
Species: Hu
Applications: ICC, IP, WB
NBP1-31555
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P

Publications for FUT10 Antibody (NBP2-31724) (0)

There are no publications for FUT10 Antibody (NBP2-31724).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FUT10 Antibody (NBP2-31724) (0)

There are no reviews for FUT10 Antibody (NBP2-31724). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FUT10 Antibody (NBP2-31724) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FUT10 Products

Array NBP2-31724

Research Areas for FUT10 Antibody (NBP2-31724)

Find related products by research area.

Blogs on FUT10

There are no specific blogs for FUT10, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FUT10 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol FUT10
Uniprot