FLJ23834 Antibody (8E8)

Images

 
Immunocytochemistry/ Immunofluorescence: FLJ23834 Antibody (8E8) [H00222256-M03] - Analysis of monoclonal antibody to FLJ23834 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: FLJ23834 Antibody (8E8) [H00222256-M03] - Detection limit for recombinant GST tagged FLJ23834 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
8E8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FLJ23834 Antibody (8E8) Summary

Immunogen
FLJ23834 (NP_689963, 776 a.a. ~ 886 a.a) partial recombinant protein with GST tag.IFDGEAIDPVTGETYEFNSKTGARKWKDPLTQMPKWKESSHQ GAAPRRVTAGEGMGSLRSANWEEDELSGKAWAEDAGLGSRNE GGKLGNPKNRNPAFMNRAYPKPHPGK
Specificity
FLJ23834 - hypothetical protein FLJ23834
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDHR3
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. It is also useful for immunofluorescence.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FLJ23834 Antibody (8E8)

  • Cadherin-like protein 28
  • cadherin-related family member 3
  • CDH28MGC133292
  • FLJ23834
  • FLJ43271
  • FLJ44366
  • MGC133293

Background

The function of the FLJ23834 protein is unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FLJ23834 Antibody (H00222256-M03) (0)

There are no publications for FLJ23834 Antibody (H00222256-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLJ23834 Antibody (H00222256-M03) (0)

There are no reviews for FLJ23834 Antibody (H00222256-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FLJ23834 Antibody (H00222256-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FLJ23834 Products

Bioinformatics Tool for FLJ23834 Antibody (H00222256-M03)

Discover related pathways, diseases and genes to FLJ23834 Antibody (H00222256-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FLJ23834

There are no specific blogs for FLJ23834, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FLJ23834 Antibody (8E8) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDHR3
Entrez
Uniprot