![Immunocytochemistry/Immunofluorescence: EFL-1 Antibody [44960002] - This image is specific to animal number SDQ3590 MeOH fixation. Dilution 1:500](http://images.novusbio.com/fullsize/EFL-1-Antibody-Immunocytochemistry-Immunofluorescence-44960002-img0002.jpg "Immunocytochemistry/Immunofluorescence: EFL-1 Antibody [44960002] - This image is specific to animal number SDQ3590 MeOH fixation. Dilution 1:500")
| Immunogen | In vivo generated recominant protein fragment |
| Epitope | MEDSYNDMEDPGFRQLSDMELQKALEMTKQSSIKNNLMLGLDNELDFDFDFDEDEDLDQPQMGTRADKSLGLLAKRFIRMIQYSPYGRCDLNTAAEALNV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody is useful in Chromatin Immunoprecipitation, ELISA and Immunofluorescence. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl |
| Preservative | No Preservative |
| Concentration | 1 mg/ml |
| Purity | Immunogen affinity purified |
| Publication using 44960002 | Applications | Species |
|---|---|---|
| Kudron M, Niu W, Lu Z et al. Tissue-specific direct targets of Caenorhabditis elegans Rb/E2F dictate distinct somatic and germline programs. Genome Biol. 2013-01-23 [PMID: 23347407] (Chemotaxis, C. elegans) | Chemotaxis | C. elegans |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Michelle Kudron |
ChIP | Other | 12/18/2013 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for EFL-1 Antibody (44960002)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
