CDADC1 Antibody (1A2) - Azide and BSA Free

Western Blot: CDADC1 Antibody (1A2) [H00081602-M01] - CDADC1 monoclonal antibody (M01), clone 1A2. Analysis of CDADC1 expression in NIH/3T3.

Immunohistochemistry-Paraffin: CDADC1 Antibody (1A2) [H00081602-M01] - Analysis of monoclonal antibody to CDADC1 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 1 ug/ml.

Western Blot: CDADC1 Antibody (1A2) [H00081602-M01] - Analysis of CDADC1 over-expressed 293 cell line, cotransfected with CDADC1 Validated Chimera RNAi ( Cat # H00081602-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CDADC1 monoclonal antibody (M01), clone 1A2 (Cat # H00081602-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: CDADC1 Antibody (1A2) [H00081602-M01] - CDADC1 monoclonal antibody (M01), clone 1A2. Analysis of CDADC1 expression in Raw 264.7.

Western Blot: CDADC1 Antibody (1A2) [H00081602-M01] - Analysis of CDADC1 expression in transfected 293T cell line by CDADC1 monoclonal antibody (M01), clone 1A2.Lane 1: CDADC1 transfected lysate(58.5 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: CDADC1 Antibody (1A2) [H00081602-M01] - Detection limit for recombinant GST tagged CDADC1 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, IHC, KD
• Clone: 1A2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CDADC1 Antibody (1A2) - Azide and BSA Free Summary

• Immunogen: CDADC1 (NP_112173, 423 a.a. ~ 514 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISYMRFGELEGVSKFTWQLNPSGAYGLEQNEPERRENGVLRPVPQKEEQHQDKKLRLGIH
• Specificity: CDADC1 - cytidine and dCMP deaminase domain containing 1
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CDADC1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin), RNAi validation, and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDADC1 Antibody (1A2) - Azide and BSA Free

• bA103J18.1
• cytidine and dCMP deaminase domain containing 1
• cytidine and dCMP deaminase domain-containing protein 1
• MGC150615
• MGC41774
• MGC57136
• NYD-SP15
• protein kinase NYD-SP15
• Testis development protein NYD-SP15

Background

CDADC1 may play an important role in testicular development and spermatogenesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDADC1
• Entrez:
  • 81602(Human)
• Uniprot:
  • NP_112173(Human)