C11orf68 Antibody


Immunocytochemistry/ Immunofluorescence: C11orf68 Antibody [NBP1-91712] - Staining of human cell line U-251 MG shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: C11orf68 Antibody [NBP1-91712] - Staining of human parathyroid gland shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC

Order Details

C11orf68 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: AAWEALQTSGRPITPGTLRQLAITHHVLSGKWLMHLAPGFKLDHAWAGIARAVVEGQLQVAKVSPRAKEGGRQVICVYTD
Predicted Species
Mouse (96%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C11orf68 Recombinant Protein Antigen (NBP1-91712PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for C11orf68 Antibody

  • basophilic leukemia expressed protein BLES03
  • Basophilic leukemia-expressed protein Bles03
  • BLES03
  • chromosome 11 open reading frame 68
  • P5326
  • Protein p5326


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C11orf68 Antibody (NBP1-91712) (0)

There are no publications for C11orf68 Antibody (NBP1-91712).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C11orf68 Antibody (NBP1-91712) (0)

There are no reviews for C11orf68 Antibody (NBP1-91712). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C11orf68 Antibody (NBP1-91712) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our C11orf68 Antibody and receive a gift card or discount.


Gene Symbol C11orf68